PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G354800.1.p
Common NameGLYMA_13G354800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 357aa    MW: 38627.4 Da    PI: 9.2812
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G354800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-13111155347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  Glyma.13G354800.1.p 111 PWTEEEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKY 155
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.0E-4223IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129420.98104160IPR017930Myb domain
SuperFamilySSF466898.97E-17106160IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-18107159IPR006447Myb domain, plants
SMARTSM007172.6E-10108158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-11108154IPR009057Homeodomain-like
PfamPF002496.6E-11111155IPR001005SANT/Myb domain
CDDcd001675.76E-9111156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGGGVKLFG VRLTDGSIIK KSASMGNLNL SSAAAHHQFH  60
SSPSSSNLAA APSSPNPSSP CSDPPQGYLS DDPAHVSTFA NRRGDRKKGV PWTEEEHRLF  120
LIGLQKLGKG DWRGIARNFV VSRTPTQVAS HAQKYFIRQS HATRRKRRSS LFDMVPDMSS  180
DQPSVPEEQV LLPPSQNSQP CNGKSQPSLN LSLKSEFEPM ETTSQENAQQ TNETMMGSIG  240
LTPMAPHGFF PAYLPVPFPM WPSTVAPPFE EVKGGETSHH QIHKPIPVIP KEPVNVDELV  300
GMSHLSIGEA KVRDREPSPL SLKLLGEPSR QSAFHANAPV GTSDLNNGKD NAIQAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.329990.0flower| leaf| stem
Function -- GeneRIF ? help Back to Top
  1. GmMYB62 is reported as a new R1 MYB client protein of soybean 14-3-3s that may function together with GmMYB176 for gene regulation in soybean.
    [PMID: 22836494]
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-180AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593489.10.0PREDICTED: MYB transcription factor MYB62 isoform X1
TrEMBLA0A0B2RLB00.0A0A0B2RLB0_GLYSO; Transcription factor MYB1R1
TrEMBLA0A0R4J5530.0A0A0R4J553_SOYBN; Uncharacterized protein
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-104MYB_related family protein
Publications ? help Back to Top
  1. Li X,Dhaubhadel S
    14-3-3 proteins act as scaffolds for GmMYB62 and GmMYB176 and regulate their intracellular localization in soybean.
    Plant Signal Behav, 2012. 7(8): p. 965-8
    [PMID:22836494]